Primary Antibodies

View as table Download

Rabbit polyclonal anti-FZD10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD10.

Rabbit Polyclonal Frizzled-10 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 150-200 of human Frizzled-10 was used as the immunogen

Rabbit Polyclonal Anti-FZD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF