LDLR mouse monoclonal antibody,clone OTI7C5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LDLR mouse monoclonal antibody,clone OTI7C5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LDLR mouse monoclonal antibody,clone OTI8D12
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LDLR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LDLR antibody is: synthetic peptide directed towards the C-terminal region of Human LDLR. Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA |
LDL Receptor (LDLR) (500-550) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
LDLR mouse monoclonal antibody,clone OTI4E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |