Primary Antibodies

View as table Download

GSTO2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), Biotinylated

Applications WB
Reactivities Human, Rat
Conjugation Biotin

GSTO2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), HRP conjugated

Applications WB
Reactivities Human, Rat
Conjugation HRP

GSTO2 mouse monoclonal antibody, clone OTI5E7 (formerly 5E7), Biotinylated

Applications WB
Reactivities Human, Rat
Conjugation Biotin

GSTO2 mouse monoclonal antibody, clone OTI5E7 (formerly 5E7), HRP conjugated

Applications WB
Reactivities Human, Rat
Conjugation HRP

GSTO2 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1), Biotinylated

Applications WB
Reactivities Human, Rat
Conjugation Biotin

GSTO2 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1), HRP conjugated

Applications WB
Reactivities Human, Rat
Conjugation HRP

GSTO2 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), Biotinylated

Applications WB
Reactivities Human, Rat
Conjugation Biotin

GSTO2 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), HRP conjugated

Applications WB
Reactivities Human, Rat
Conjugation HRP

GSTO2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit polyclonal Anti-GSTO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTO2 antibody: synthetic peptide directed towards the N terminal of human GSTO2. Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV

Rabbit anti-GSTO2 Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human GSTO2

GSTO2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

GSTO2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

GSTO2 mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated