GSTO2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
GSTO2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GSTO2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
GSTO2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GSTO2 mouse monoclonal antibody, clone OTI5E7 (formerly 5E7), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
GSTO2 mouse monoclonal antibody, clone OTI5E7 (formerly 5E7), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GSTO2 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
GSTO2 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GSTO2 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
GSTO2 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
GSTO2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-GSTO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTO2 antibody: synthetic peptide directed towards the N terminal of human GSTO2. Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV |
Rabbit anti-GSTO2 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GSTO2 |
GSTO2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
GSTO2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
GSTO2 mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |