Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Pig, Bovine, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559) |
Rabbit Polyclonal antibody to beta Actin (actin, beta)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Dog, Rabbit, Chicken, Sheep, Chimpanzee, Bovine, Guinea Pig, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rat, Rabbit, Guinea Pig, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 293 and 387 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1) |
Rabbit anti Actin, skeletal muscle Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Rabbit, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human alpha skeletal muscle isoforms of actin. This sequence is identical in human, rat, mouse, dog, bovine, guinea pig, sheep and frog origins. |
Rabbit Polyclonal Antibody against VEGFA
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Human, Rabbit, Rat, Sheep, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
C3 goat polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, WB |
| Reactivities | Guinea Pig |
| Conjugation | Biotin |
| Immunogen | C3c is isolated and purified from pooled normal guinea pig serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C3 goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IP, WB |
| Reactivities | Guinea Pig |
| Conjugation | FITC |
| Immunogen | C3c is isolated and purified from pooled normal guinea pig serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C3 goat polyclonal antibody, HRP
| Applications | ELISA, ID, IF, IP, WB |
| Reactivities | Guinea Pig |
| Conjugation | HRP |
| Immunogen | C3c is isolated and purified from pooled normal guinea pig serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal antibody to RAMP1 (receptor (G protein-coupled) activity modifying protein 1)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig, Guinea Pig, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 84 and 148 of RAMP1 (Uniprot ID#O60894) |
Rabbit Polyclonal Anti-FAM86A Antibody
| Applications | WB |
| Reactivities | Human (Predicted: Rat, Dog, Cow, Guinea Pig, Horse) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
Germany
Japan
United Kingdom
China
