Primary Antibodies

View as table Download

PNPLA3 Rabbit monoclonal antibody,clone OTIR1D10

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Rabbit Polyclonal Anti-PNPLA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS

Anti-AOX1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1

Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172)

Goat Polyclonal Antibody against PNPLA3

Applications IHC, PEP-ELISA, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence EHDICPKVKSTN, from the internal region of the protein sequence according to NP_473429.2.

Anti-TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase

Anti-ALDH3A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1

Anti-ALDH3B1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member B1

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT1

Rabbit Polyclonal Anti-DBH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DBH

Rabbit Polyclonal Anti-GOT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT2

Anti-ADH1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human alcohol dehydrogenase 1A (class I), alpha polypeptide

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase

Rabbit Polyclonal Anti-FAH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG