Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1D

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.

Rabbit polyclonal anti-Clock antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Clock.

Rabbit polyclonal antibody to SHARP2 (basic helix-loop-helix domain containing, class B, 2)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 81 of SHARP2 (Uniprot ID#O14503)

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF

Goat Polyclonal Antibody against Casein Kinase 1, delta

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1.

Rabbit Polyclonal Anti-ARNTL Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARNTL

Goat Polyclonal Antibody against CSNK1E

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1.

Goat Anti-BMAL1 / ARNTL Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence REKITTNCYKFKIKD, from the internal region of the protein sequence according to NP_001169.3; NP_001025444.1.

Rabbit anti-CLOCK polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit polyclonal anti-CRY1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CRY1.

Rabbit Polyclonal Anti-Clock Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clock Antibody: A synthesized peptide derived from human Clock

Rabbit Polyclonal Anti-BHLHB3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3