Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 10 of 10 results

(reset)

Her2 (ERBB2) Mouse Monoclonal Antibody [Clone ID: UMAB36]

UM500036

USD 564.00

4 Weeks

Purified HER2 (ERBB2) mouse monoclonal antibody,clone UMAB36

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Monkey
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

EGFR Mouse Monoclonal Antibody [Clone ID: UMAB95]

UM500070

USD 564.00

In Stock

EGFR mouse monoclonal antibody,clone UMAB95

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

EGFR Mouse Monoclonal Antibody [Clone ID: UMAB95]

UM570070

USD 224.00

In Stock

EGFR mouse monoclonal antibody,clone UMAB95

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Her2 (ERBB2) Mouse Monoclonal Antibody [Clone ID: UMAB36]

UM500036CF

USD 657.00

3 Days

Carrier-free (BSA/glycerol-free) Purified HER2 (ERBB2) mouse monoclonal antibody,clone UMAB36

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Monkey
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Her2 (ERBB2) Mouse Monoclonal Antibody [Clone ID: UMAB36]

UM570036

USD 224.00

In Stock

Purified HER2 (ERBB2) mouse monoclonal antibody,clone UMAB36

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Monkey
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

EGFR Mouse Monoclonal Antibody [Clone ID: UMAB95]

UM500070CF

USD 657.00

3 Days

Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone UMAB95

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

SRD5A2 Rabbit Polyclonal Antibody

TA335223

USD 539.00

5 Days

Rabbit Polyclonal Anti-SRD5A2 Antibody

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR

1 / 3

2 / 3

3 / 3

Previous Next

Her2 (ERBB2) Goat Polyclonal Antibody

AB0088-200

USD 355.00

In Stock

Goat Polyclonal Anti-ERBB2 Antibody

Applications	WB
Reactivities	Human, Rat, Mouse, Canine, Monkey
Conjugation	Unconjugated
Immunogen	Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli.

SRD5A2 Rabbit Polyclonal Antibody

TA335224

USD 539.00

5 Days

Rabbit Polyclonal Anti-SRD5A2 Antibody

Applications	WB
Reactivities	Human, Monkey
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL

1 / 2

2 / 2

Previous Next

EGFR Goat Polyclonal Antibody

AB0106-100

USD 355.00

In Stock

Goat Polyclonal Anti-ERBB1 Antibody

Applications	WB
Reactivities	Human, Rat, Mouse, Canine, Monkey
Conjugation	Unconjugated
Immunogen	Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli.

1 - 10 of 10 results