Primary Antibodies

View as table Download

RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CoREST (RCOR1) mouse monoclonal antibody, clone K72/8

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RCOR1 Antibody: synthetic peptide directed towards the middle region of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the C terminal of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS