Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI12G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI12G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C2 mouse monoclonal antibody,clone OTI12G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C2 mouse monoclonal antibody,clone OTI1A7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C2 mouse monoclonal antibody,clone OTI12G10, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
C2 mouse monoclonal antibody,clone OTI12G10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI1A7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C2 mouse monoclonal antibody,clone OTI1A7, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
C2 mouse monoclonal antibody,clone OTI1A7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
C2 mouse monoclonal antibody,clone OTI12G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to Complement C2 (complement component 2)
Applications | IF, WB |
Reactivities | Human (Predicted: Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 265 and 642 of Complement C2 (Uniprot ID#P06681) |
C2 mouse monoclonal antibody,clone OTI1A7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ |
C2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Hamster, Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 147-176 amino acids from the N-terminal region of human C2 |
Rabbit Polyclonal Anti-C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS |
C2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C2 |