Primary Antibodies

Jump to Filters
View as table Download
Polycystin 2 (PKD2) Rabbit Polyclonal Antibody
TA328750

USD 850.00

2 Weeks

Rabbit Polyclonal Anti-TRPP1 (PKD2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)ERWESDDAASQISH, corresponding to amino acid residues 914-927 of human TRPP1. Intracellular, C-terminus.
TRPA1 Rabbit Polyclonal Antibody
TA328744

USD 850.00

2 Weeks

Rabbit Polyclonal Anti-TRPA1 (extracellular)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NSTGIINETSDHSE, corresponding to amino acid residues 747-760 of human TRPA1. 1st extracellular loop.
TRPM8 Mouse Monoclonal Antibody [Clone ID: OTI7A11]
CF811228

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) TRPM8 mouse monoclonal antibody,clone OTI7A11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TRPM4 Rabbit Polyclonal Antibody
TA338581

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRPM4 Antibody

Applications WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
TRPM7 Rabbit Polyclonal Antibody
TA328749

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-TRPM7

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CKRRKKDKTSDGPKLFLTEE, corresponding to amino acid residues 1146-1165 of human TRPM7. Intracellular, C-terminus.
VR1 (TRPV1) Rabbit Polyclonal Antibody
TA890016

USD 407.00

In Stock

Rabbit polyclonal anti-TRPV1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TRPV1
TRPM8 Rabbit Polyclonal Antibody
TA336867

USD 550.00

5 Days

Rabbit Polyclonal TRPM8 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TRPM8 protein (between residues 250-300) [UniProt Q7Z2W7]
TRPA1 Rabbit Polyclonal Antibody
TA338564

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-TRPA1 Antibody

Applications IHC, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL
TRPM8 Rabbit Polyclonal Antibody
TA328652

USD 850.00

2 Weeks

Rabbit Polyclonal Anti-TRPM8 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide SDVDGTTYDFAHC, corresponding to amino acid residues 917-929 of human TRPM8. 3rd extracellular loop.
TRPC1 Rabbit Polyclonal Antibody
TA328677

USD 905.00

3 Weeks

Rabbit Polyclonal Anti-TRPC1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular.
Mucolipin 1 (MCOLN1) Rabbit Polyclonal Antibody
TA309745

USD 550.00

5 Days

Rabbit Polyclonal Mucolipin 1 Antibody

Applications Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the mouse protein (within residues 500-580). [Swiss-Prot# Q99J21]