Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal IPF Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the C-terminal region of human IPF. |
Rabbit Polyclonal Anti-PDX1 Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1. Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF |
Rabbit anti-PDX1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PDX1 |
PDX1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PDX1 mouse monoclonal antibody, clone OTI7F7 (formerly 7F7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- PDX1
Applications
- WB
Families
- Embryonic stem cells
Pathways
- Type II diabetes mellitus