Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Antibody against Eg5
| Applications | ICC/IF, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
USD 410.00
2 Weeks
Complement C5 (C5) (neoepitope) mouse monoclonal antibody, clone HCC5b.1 (neo), Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Goat, Human, Porcine, Primate |
| Conjugation | Unconjugated |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Bovine Luteinizing Hormone |
Rabbit Polyclonal Antibody against TPX2
| Applications | FC, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunizing rabbits with a recombinant segment of the C-terminal domain of the human protein |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Bovine Luteinizing Hormone |
Rabbit Polyclonal Lactoperoxidase Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Bovine, Goat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a C-terminal portion of the human Lactoperoxidase protein (within residues 650-712). [Swiss-Prot# P22079] |
Active filters
Reactivities
- Goat
Applications
- WB
Families
- Druggable Genome
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Assay Types
Pathways
- Alzheimer's disease (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- GnRH signaling pathway (2)
- Neuroactive ligand-receptor interaction (2)
- Adipocytokine signaling pathway (1)
- Apoptosis (1)
- Arginine and proline metabolism (1)
- B cell receptor signaling pathway (1)
- Calcium signaling pathway (1)
- Complement and coagulation cascades (1)
- Cytokine-cytokine receptor interaction (1)
- Gap junction (1)
- Long-term depression (1)
- MAPK signaling pathway (1)
- Metabolic pathways (1)
- Pathogenic Escherichia coli infection (1)
- Pathways in cancer (1)
- Prion diseases (1)
- Small cell lung cancer (1)
- Systemic lupus erythematosus (1)