Mouse Monoclonal CD81 Antibody (1D6)
Applications | CyTOF-ready, Dot, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Goat, Primate, Sheep |
Conjugation | Unconjugated |
Mouse Monoclonal CD81 Antibody (1D6)
Applications | CyTOF-ready, Dot, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Goat, Primate, Sheep |
Conjugation | Unconjugated |
Mouse Monoclonal beta Tubulin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Hamster, Rat, Monkey, Goat, Chlamydomonas |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against Eg5
Applications | ICC/IF, Immunoblotting, IP, WB |
Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
Conjugation | Unconjugated |
Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
USD 410.00
2 Weeks
Complement C5 (C5) (neoepitope) mouse monoclonal antibody, clone HCC5b.1 (neo), Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Goat, Human, Porcine, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal SOX9 Antibody
Applications | IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Canine, Feline, Goat, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 225-275 of human SOX9 was used as the immunogen for this antibody. |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, R, WB |
Reactivities | Bovine, Deer, Goat, Human, Sheep |
Conjugation | Unconjugated |
Immunogen | Bovine Luteinizing Hormone |
Rabbit Polyclonal Antibody against TPX2
Applications | FC, ICC/IF, IP, Simple Western, WB |
Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
Conjugation | Unconjugated |
Immunogen | Produced by immunizing rabbits with a recombinant segment of the C-terminal domain of the human protein |
Rabbit Polyclonal Anti-RHOC Antibody
Applications | IHC, WB |
Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
NOS1 (1-181) mouse monoclonal antibody, clone N1, Purified
Applications | IHC, WB |
Reactivities | Goat, Human, Porcine, Rat |
Conjugation | Unconjugated |
TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Goat, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211). |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, R, WB |
Reactivities | Bovine, Deer, Goat, Human, Sheep |
Conjugation | Unconjugated |
Immunogen | Bovine Luteinizing Hormone |
Rabbit Polyclonal Lactoperoxidase Antibody
Applications | WB |
Reactivities | Human, Mouse, Bovine, Goat, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human Lactoperoxidase protein (within residues 650-712). [Swiss-Prot# P22079] |