Primary Antibodies

View as table Download

Rabbit Polyclonal Trail Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRAIL antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRAIL. The immunogen is located within the last 50 amino acids of Trail.

Rabbit polyclonal anti-CD253 / TNFSF10 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD253.

Rabbit Polyclonal Anti-CD253 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253

Rabbit anti CD253/TRAIL/ (TNFSF10) (IN1) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of TRAIL protein (from 115aa-140aa). This sequence is identical to human and mouse.

Rabbit Polyclonal Anti-TNFSF10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF10 antibody: synthetic peptide directed towards the N terminal of human TNFSF10. Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE

Rabbit anti CD253/TRAIL (IN2) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence of human TRAIL protein (from 160aa-190aa). This sequence is has one amino acid difference from rat origin.

Rabbit anti CD253/TRAIL (CT) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of TRAIL protein (from 230aa-280aa). This sequence is identical to human, rat and mouse.