Germany
Japan
United Kingdom
China
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody, clone OTI8C10 (formerly 8C10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI8C10 (formerly 8C10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody, clone OTI11C11 (formerly 11C11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI11C11 (formerly 11C11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IFIH1 mouse monoclonal antibody,clone OTI12A6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody,clone OTI12A6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IFIH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFIH1 antibody: synthetic peptide directed towards the middle region of human IFIH1. Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED |
IFIH1 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFIH1 |
Active filters
Target Symbol
- MDA5
Reactivities
- Human
Applications
- WB
Conjugates
- Unconjugated
Pathways
- RIG-I-like receptor signaling pathway