Primary Antibodies

View as table Download

Rabbit polyclonal HNF1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B.

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal anti-Sox2 Antibody, clone OR-4F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431]

Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200).

Rabbit Polyclonal Anti-OTX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT

Rabbit polyclonal KLF4 Antibody (N-term C74)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4.

Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8
Modifications Phospho-specific

GATA6 Rabbit monoclonal antibody,clone OTIR5F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATA6 Rabbit monoclonal antibody,clone OTIR5B8

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

GATA6 Rabbit monoclonal antibody,clone OTIR3H6

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-DNMT3B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44