Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal KLF5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chicken, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Anti-IGFBP1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 237-249 amino acids of human insulin-like growth factor binding protein 1 |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Xenopus, Dog, Chimpanzee, Chicken, Quail |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal NeuroD1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
Rabbit Polyclonal Anti-GATA6 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the N terminal of human GATA6. Synthetic peptide located within the following region: PEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTR |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Active filters
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Embryonic stem cells
Filter by
Category
Target Symbol
- SMAD3 (17)
- SMAD2 (12)
- SOX2 (11)
- C-MYC (10)
- FOXA2 (9)
- GATA6 (9)
- HNF1 BETA (9)
- OCT4 (9)
- CD117 (8)
- DNMT3B (8)
- SOX9 (8)
- FGF4 (7)
- KLF4 (7)
- NEUROD1 (7)
- BDNF (6)
- PAX3 (6)
- CD44 (5)
- CDX2 (5)
- GATA4 (5)
- NANOG (5)
- REX1 (5)
- BMP7 (4)
- EGF (4)
- IGFBP2 (4)
- OTX2 (4)
- PAX7 (4)
- PDGFC (4)
- PDX1 (4)
- PTF1A (4)
- BMP6 (3)
- CD9 (3)
- IGFBP1 (3)
- BMP15 (2)
- BMP2 (2)
- BMP8B (2)
- BXDC2 (2)
- EOMES (2)
- GDF7 (2)
- GLI2 (2)
- GRB7 (2)
- KLF5 (2)
- NODAL (2)
- PAX4 (2)
- PAX6 (2)
- PROX1 (2)
- BMP4 (1)
- BMP5 (1)
- CCN4 (1)
- CD14 (1)
- CD34 (1)
- CRIPTO1 (1)
- DPPA2 (1)
- FGF10 (1)
- GDF 5 (1)
- GDF 9 (1)
- GDF3 (1)
- GLI3 (1)
- HBZ (1)
- TAT (1)
- UTF1 (1)
- ZIC3 (1)
Reactivities
Antibody Hosts
Clonalities
Modifications
Assay Types
Pathways
- Pathways in cancer (65)
- TGF-beta signaling pathway (57)
- Cell cycle (39)
- Colorectal cancer (39)
- Wnt signaling pathway (39)
- Maturity onset diabetes of the young (33)
- Pancreatic cancer (33)
- Adherens junction (29)
- MAPK signaling pathway (29)
- Chronic myeloid leukemia (27)
- Cytokine-cytokine receptor interaction (23)
- Acute myeloid leukemia (20)
- Hematopoietic cell lineage (20)
- Regulation of actin cytoskeleton (17)
- Hedgehog signaling pathway (16)
- Melanoma (16)
- Bladder cancer (14)
- Endocytosis (14)
- Endometrial cancer (14)
- ErbB signaling pathway (14)
- Jak-STAT signaling pathway (10)
- Melanogenesis (10)
- Small cell lung cancer (10)
- Thyroid cancer (10)
- Cysteine and methionine metabolism (9)
- Metabolic pathways (9)
- Focal adhesion (8)
- Gap junction (8)
- Prostate cancer (8)
- Basal cell carcinoma (6)
- Huntington's disease (6)
- Neurotrophin signaling pathway (6)
- ECM-receptor interaction (5)
- Glioma (4)
- Non-small cell lung cancer (4)
- Type II diabetes mellitus (4)
- Cell adhesion molecules (CAMs) (1)
- Pathogenic Escherichia coli infection (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Toll-like receptor signaling pathway (1)
- Tyrosine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)