Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Equine, Guinea Pig, Hamster, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Peptide from the C Terminus of the protein sequence according to NP_000691.1 |
Rabbit polyclonal antibody to Annexin A1 (annexin A1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Feline, Pig, Rabbit, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of Annexin A1 (Uniprot ID#P04083) |
Rabbit Polyclonal Anti-ANXA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD |
ANXA1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANXA1 |
Anti-ANXA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-ANXA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Annexin A1 (ANXA1) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ANKRD6 |
Goat Anti-Annexin I Antibody
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Cow, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CQAILDETKGDYEK, from the C Terminus of the protein sequence according to NP_000691.1. |
Germany
Japan
United Kingdom
China
