Primary Antibodies

View as table Download

Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8
Modifications Phospho-specific

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Rabbit polyclonal SMAD3-S208 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Chicken, Pig)
Conjugation Unconjugated
Immunogen This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3.

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6

Rabbit Polyclonal Anti-SMAD3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMAD3

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Anti-SMAD5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5

Rabbit polyclonal SMAD2 Antibody

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Rat, Zebrafish, Bovine, Chicken, Drosophila, Pig)
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2.

Rabbit polyclonal Smad1 (Ab-187) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Smad1 around the phosphorylation site of serine 187 (P-H-SP-P-N).

Rabbit polyclonal Smad1 (Ser465) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Smad1 around the phosphorylation site of serine 465 (I-S-S-V-SP)
Modifications Phospho-specific

Rabbit polyclonal Smad1 (Ab-465) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Smad1 around the phosphorylation site of serine 465 (I-S-S-V-SP).

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP