Rabbit polyclonal anti-Cyclin E1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin E1. |
Rabbit polyclonal anti-Cyclin E1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin E1. |
DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3. |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal anti-HDAC-1 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Rabbit Polyclonal Gli1 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151] |
Anti-HDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 469-482 amino acids of Human histone deacetylase 1 |
Anti-HDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 469-482 amino acids of Human histone deacetylase 1 |
Rabbit Polyclonal anti-STAT6 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
Anti-NOTCH1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of Human notch 1 |
Rabbit Polyclonal DLL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody. |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Smoothened (SMO) (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SMO antibody was raised against synthetic peptide - KLH conjugated |
Rabbit Polyclonal Notch-1 Antibody
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human NOTCH1 protein (between residues 2300-2350) [UniProt P46531] |
DLL4 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |