USD 447.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
Anti-CA9 (Carbonic Anhydrase IX) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 200.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 570.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
Conjugation | Unconjugated |
USD 315.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
Conjugation | Unconjugated |
USD 200.00
2 Days
Anti-CA9 (Carbonic Anhydrase IX) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GLS Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT |
Carbonic Anhydrase IX (CA9) (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CA9 |