Primary Antibodies

View as table Download

PIK3CB (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human PI3KCB.

PI3 Kinase p110 beta Rabbit polyclonal Antibody

Applications FC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human PI3 Kinase p110 beta

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD

PI3 Kinase p110 beta Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated

PIK3CB Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified PIK3C-β antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an N-terminal region of human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform.

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE

PI3 Kinase p110 beta Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 771-1070 of human PI3 Kinase p110 beta (NP_006210.1).
Modifications Unmodified