Primary Antibodies

Jump to Filters
View as table Download
KIR2DL5A Rabbit Polyclonal Antibody
TA338022

USD 539.00

5 Days

Rabbit Polyclonal Anti-KIR2DL5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIR2DL5A antibody is: synthetic peptide directed towards the C-terminal region of Human KIR2DL5A. Synthetic peptide located within the following region: QLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQA
KIR2DL5A Rabbit Polyclonal Antibody
TA368624

USD 380.00

4 Weeks

KIR2DL5A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KIR2DL5A
KIR2DL5A Rabbit Polyclonal Antibody
TA372859

USD 380.00

4 Weeks

KIR2DL5A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KIR2DL5A
KIR2DL5A Rabbit Polyclonal Antibody
TA360478

USD 539.00

5 Days

KIR2DL5A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KIR2DL5A