Anti-EDAR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 148-161 amino acids of Human Ectodysplasin-A receptor |
Anti-EDAR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 148-161 amino acids of Human Ectodysplasin-A receptor |
Rabbit Polyclonal Anti-EDAR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EDAR antibody: synthetic peptide directed towards the middle region of human EDAR. Synthetic peptide located within the following region: PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV |
EDAR mouse monoclonal antibody, clone AT19E8, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
EDAR mouse monoclonal antibody, clone AT19E8, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Recombinant Anti-EDAR (Clone EDAR12)
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat, Dog, Chicken |
Conjugation | Unconjugated |
Recombinant Anti-EDAR (Clone EDAR12)
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat, Dog, Chicken |
Conjugation | Unconjugated |