Primary Antibodies

Jump to Filters
View as table Download
EDAR Rabbit Polyclonal Antibody
TA321894

USD 380.00

4 Weeks

Anti-EDAR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 148-161 amino acids of Human Ectodysplasin-A receptor
EDAR Rabbit Polyclonal Antibody
TA338493

USD 539.00

5 Days

Rabbit Polyclonal Anti-EDAR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDAR antibody: synthetic peptide directed towards the middle region of human EDAR. Synthetic peptide located within the following region: PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV
EDAR Mouse Monoclonal Antibody [Clone ID: AT19E8]
AM50358PU-N

USD 430.00

3 Weeks

EDAR mouse monoclonal antibody, clone AT19E8, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
EDAR Mouse Monoclonal Antibody [Clone ID: AT19E8]
AM50358PU-S

USD 315.00

3 Weeks

EDAR mouse monoclonal antibody, clone AT19E8, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Edar Mouse Monoclonal Antibody [Clone ID: EDAR12]
TA386102

USD 630.00

2 Weeks

Recombinant Anti-EDAR (Clone EDAR12)

Applications ELISA, WB
Reactivities Human, Mouse, Rat, Dog, Chicken
Conjugation Unconjugated
Edar Rabbit Monoclonal Antibody [Clone ID: EDAR12]
TA386103

USD 630.00

2 Weeks

Recombinant Anti-EDAR (Clone EDAR12)

Applications ELISA, WB
Reactivities Human, Mouse, Rat, Dog, Chicken
Conjugation Unconjugated