Primary Antibodies

Jump to Filters
View as table Download
CARD8 Rabbit Polyclonal Antibody
TA306138

USD 570.00

In Stock

Rabbit Polyclonal CARD8 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CARD8 antibody was raised against a synthetic peptide corresponding to amino acids at the C-terminus of human CARD8.
CARD8 Rabbit Polyclonal Antibody
TA326822

USD 365.00

3 Weeks

CARD8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CARD8
CARD8 Rabbit Polyclonal Antibody
TA334072

USD 539.00

5 Days

Rabbit Polyclonal Anti-CARD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CARD8 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARD8. Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID