Primary Antibodies

View as table Download

Rabbit Polyclonal anti-STAT6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM

STAT6 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human STAT6 (NP_001171550.1).
Modifications Unmodified

Rabbit polyclonal STAT6 (Ab-641) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641.

STAT6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around amino acids 639~643 (R-G-Y-V-P) derived from Human STAT6.

STAT6 pThr645 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

STAT6 mouse monoclonal antibody, clone 7D3, Ascites

Applications ELISA, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

STAT6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 610-660 of Human Stat6.

STAT6 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human STAT6

STAT6 pTyr641 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

STAT6 pTyr641 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641 (R-G-YP-V-P).

STAT6 pTyr641 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641 (R-G-YP-V-P).

STAT6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around amino acids 639~643 (R-G-Y-V-P) derived from Human STAT6.

STAT6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of threonine 645 (P-A-TP-I-K).

STAT6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of threonine 645 (P-A-TP-I-K).

STAT6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 600-650 of Human Stat6.