Primary Antibodies

Jump to Filters
View as table Download
ATG4D (227-257) Rabbit Polyclonal Antibody
AP32202PU-N

USD 580.00

2 Weeks

ATG4D (227-257) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 227~257 amino acids from the Center of Human APG4D
ATG4D Rabbit Polyclonal Antibody
TA349133

USD 570.00

5 Days

Rabbit Polyclonal Anti-ATG4D Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG4D antibody was raised against a 17 amino acid peptide near the amino terminus of human ATG4D.
ATG4D (N-term) Rabbit Polyclonal Antibody
AP32159PU-N

USD 580.00

2 Weeks

ATG4D (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 49-79 amino acids from the N-terminal region of Human ATG4D
ATG4D Rabbit Polyclonal Antibody
TA344179

USD 539.00

5 Days

Rabbit Polyclonal Anti-ATG4D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4D antibody: synthetic peptide directed towards the middle region of human ATG4D. Synthetic peptide located within the following region: AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP
ATG4D Rabbit Polyclonal Antibody
TA315948

USD 380.00

In Stock

Rabbit polyclonal anti-ATG4D antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ATG4D.