Mouse Monoclonal A20/TNFAIP3 Antibody (59A426)
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal A20/TNFAIP3 Antibody (59A426)
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-TNAP3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNAP3. |
TNFAIP3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNFAIP3 |
Rabbit Polyclonal Anti-TNFAIP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFAIP3 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFAIP3. Synthetic peptide located within the following region: QENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHE |