Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to Histamine H2 Receptor (histamine receptor H2)

Applications IF, IHC, WB
Reactivities Human (Predicted: Chimpanzee, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histamine H2 Receptor (Uniprot ID#P25021)

Rabbit Polyclonal Anti-HRH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HRH2

Rabbit Polyclonal Anti-HRH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HRH2 antibody is: synthetic peptide directed towards the C-terminal region of Human HRH2. Synthetic peptide located within the following region: DFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQ

HRH2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 188-218 amino acids from the Central region of human Histamine H2 receptor