Primary Antibodies

View as table Download

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IHC, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Antibody against PHPT1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-117 amino acids from the C-terminal region of human PHPT1.

Prostatic Acid Phosphatase (ACPP) (269-282) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001127666.1, NP_001090.2.

Rabbit polyclonal Tyrosinase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human tyrosinase.

Goat Polyclonal ENPP-1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human ENPP1 protein (between residues 900-925) [UniProt P22413]

Rabbit Polyclonal Antibody against PHPT1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PHPT1.

Rabbit Polyclonal Anti-ACP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

ACP2 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACP2

TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ACPP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate

ENPP1 mouse monoclonal antibody,clone OTI8C7

Applications WB
Reactivities Human
Conjugation Unconjugated

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Anti-ACPP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate