GNAL mouse monoclonal antibody,clone OTI4F2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GNAL mouse monoclonal antibody,clone OTI4F2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GNAL rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human Gα olf. |
Rabbit polyclonal anti-GNAL antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GNAL. |
Rabbit Polyclonal Anti-GNAL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAL antibody: synthetic peptide directed towards the C terminal of human GNAL. Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR |
GNAL mouse monoclonal antibody,clone OTI1C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL mouse monoclonal antibody,clone OTI2F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL mouse monoclonal antibody,clone OTI6A2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL mouse monoclonal antibody,clone OTI4F2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |