Primary Antibodies

Jump to Filters
View as table Download
VEGFC Rabbit Polyclonal Antibody
TA321716

USD 380.00

2 Weeks

Anti-VEGFC Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C
VEGFC Rabbit Polyclonal Antibody
TA385549

USD 380.00

4 Weeks

VEGFC Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human VEGFC. AA range:91-140
VEGFC Rabbit Polyclonal Antibody
TA383223

USD 365.00

3 Weeks

VEGFC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human VEGFC
Modifications Unmodified
VEGFC Rabbit Polyclonal Antibody
TA383222

USD 365.00

3 Weeks

VEGFC Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1).
Modifications Unmodified
VEGFC Rabbit Polyclonal Antibody
TA343278

USD 539.00

5 Days

Rabbit Polyclonal Anti-VEGFC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD