Rabbit Polyclonal Anti-KYNU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KYNU antibody: synthetic peptide directed towards the N terminal of human KYNU. Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK |
Rabbit Polyclonal Anti-OGDH Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OGDH antibody: synthetic peptide directed towards the N terminal of human OGDH. Synthetic peptide located within the following region: MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL |
Rabbit Polyclonal Anti-WARS Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WARS antibody: synthetic peptide directed towards the N terminal of human WARS. Synthetic peptide located within the following region: EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF |
Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS |
Rabbit Polyclonal Anti-OGDHL Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OGDHL antibody: synthetic peptide directed towards the N terminal of human OGDHL. Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR |
Rabbit Polyclonal Anti-ASMT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASMT antibody is: synthetic peptide directed towards the N-terminal region of Human ASMT. Synthetic peptide located within the following region: GSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAA |
Rabbit Polyclonal Anti-DDC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the middle region of human DDC. Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL |
Rabbit Polyclonal Anti-HAAO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAAO antibody: synthetic peptide directed towards the N terminal of human HAAO. Synthetic peptide located within the following region: HRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVG |
Rabbit Polyclonal Anti-INMT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INMT antibody: synthetic peptide directed towards the N terminal of human INMT. Synthetic peptide located within the following region: KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP |
Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2 |
Rabbit polyclonal TPH2(Ser19) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19. |
| Modifications | Phospho-specific |
Rabbit polyclonal Tryptophan Hydroxylase (Ser58) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tryptophan Hydroxylase around the phosphorylation site of serine 58 (R-N-SP-E-F). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China