Primary Antibodies

Jump to Filters
View as table Download
Cyclin D1 (CCND1) (N-term) Rabbit Polyclonal Antibody
AP23242PU-N

USD 560.00

2 Weeks

Cyclin D1 (CCND1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human Cyclin D1
SOCS1 Rabbit Polyclonal Antibody
TA346365

USD 539.00

5 Days

Rabbit Polyclonal Anti-SOCS1 Antibody

Applications WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
PIAS2 Rabbit Polyclonal Antibody
TA347490

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 Antibody: A synthesized peptide derived from human PIAS2
SOCS1 Rabbit Polyclonal Antibody
TA354506

USD 370.00

5 Days

Rabbit anti SOCS1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminus of SOCS-1 protein from human and mouse origins.