Primary Antibodies

View as table Download

IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ISG15 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

IP10 (CXCL10) mouse monoclonal antibody, Azide Free

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)

Applications WB
Reactivities Human
Conjugation Unconjugated

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated