Primary Antibodies

Jump to Filters
View as table Download
ANGPTL3 Rabbit Polyclonal Antibody
TA321837

USD 380.00

4 Weeks

Anti-ANGPTL3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of Human Angiopoietin-related protein 3
ANGPTL3 Rabbit Polyclonal Antibody
TA344097

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ANGPTL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANGPTL3 antibody: synthetic peptide directed towards the N terminal of human ANGPTL3. Synthetic peptide located within the following region: VKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEI
ANGPTL3 Rabbit Polyclonal Antibody
TA344098

USD 539.00

5 Days

Rabbit Polyclonal Anti-ANGPTL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANGPTL3 antibody: synthetic peptide directed towards the N terminal of human ANGPTL3. Synthetic peptide located within the following region: IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL
ANGPTL3 Rabbit Polyclonal Antibody
TA326849

USD 365.00

3 Weeks

Rabbit anti-ANGPTL3 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ANGPTL3