Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 509.00
2 Weeks
TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit Polyclonal Anti-TRIB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1. Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA |
TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Target Symbol
- TRIB1
Applications
- WB
Families
- Protein Kinase