Primary Antibodies

View as table Download

Goat Polyclonal Antibody against Kcnj11 (Near N-terminal)

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence ERRARFVSKKGNC, from the internal region (near the N Terminus) of the protein sequence according to NP_034732.1.

Goat Polyclonal Antibody against KCNJ11

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-AEDPAKPRYRARQ, from the internal region (near the N Terminus) of the protein sequence according to NP_000516.3.

Rabbit anti-KCNJ11 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human KCNJ11

Rabbit Polyclonal Anti-KCNJ11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KCNJ11 antibody is: synthetic peptide directed towards the middle region of HUMAN KCNJ11. Synthetic peptide located within the following region: SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLII