Primary Antibodies

Jump to Filters
View as table Download
Kv4.3 (KCND3) Rabbit Polyclonal Antibody
TA328633

USD 905.00

3 Weeks

Rabbit Polyclonal Anti-KV4.3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NEALELTGTPEEEHMGK, corresponding to amino acid residues 451-468 of human Kv4.3. Intracellular, C-terminus.
Kv4.3 (KCND3) Rabbit Polyclonal Antibody
TA338548

USD 485.00

5 Days

Rabbit Polyclonal Anti-KCND3 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-KCND3 antibody: synthetic peptide directed towards the middle region of human KCND3. Synthetic peptide located within the following region: KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE