Rabbit Polyclonal Anti-KV4.1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KRRAIRLANSTAS, corresponding to amino acid residues 538-550 of human Kv4.1. Intracellular, C-terminal domain. |
Rabbit Polyclonal Anti-KV4.1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KRRAIRLANSTAS, corresponding to amino acid residues 538-550 of human Kv4.1. Intracellular, C-terminal domain. |
Rabbit polyclonal anti-KCND1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human KCND1. |
Rabbit Polyclonal Anti-Kcnd1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Kcnd1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR |