Primary Antibodies

Jump to Filters
View as table Download
KCND1 Rabbit Polyclonal Antibody
TA328632

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-KV4.1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KRRAIRLANSTAS, corresponding to amino acid residues 538-550 of human Kv4.1. Intracellular, C-terminal domain.
KCND1 Rabbit Polyclonal Antibody
TA314126

USD 380.00

In Stock

Rabbit polyclonal anti-KCND1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human KCND1.
KCND1 Rabbit Polyclonal Antibody
TA338547

USD 539.00

5 Days

Rabbit Polyclonal Anti-Kcnd1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Kcnd1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR