Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Human, Rat, Dog, Zebrafish, Bovine, Pig, Rabbit, Mouse, Guinea Pig, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI