Primary Antibodies

View as table Download

MUM1 (IRF4) (Center) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 171-199 amino acids from the Central region of human IRF4

Rabbit Polyclonal Anti-IRF4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IRF4

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the middle region of human IRF4. Synthetic peptide located within the following region: TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

Rabbit polyclonal anti-IRF4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IRF4.

Goat Anti-IRF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HISNPEDYHRSIR, from the C Terminus of the protein sequence according to NP_002451.2.

Rat Monoclonal anti-IRF4 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF4 antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: LDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQ

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF4 Antibody: A synthesized peptide derived from human IRF4