Primary Antibodies

Jump to Filters
View as table Download
PFKM Rabbit Polyclonal Antibody
TA308655

USD 625.00

5 Days

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse (Predicted: Chicken, Dog, Pig, Rat, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)
PFKM (N-term) Rabbit Polyclonal Antibody
AP15116PU-N

USD 580.00

2 Weeks

PFKM (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human PFKM.
PFKM (C-term) Rabbit Polyclonal Antibody
AP15117PU-N

USD 580.00

2 Weeks

PFKM (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human PFKM.
PFKM Mouse Monoclonal Antibody [Clone ID: AT2F11]
AM50026PU-N

USD 430.00

3 Weeks

PFKM mouse monoclonal antibody, clone AT2F11, Purified

Applications ELISA, FC, WB
Reactivities Human
Conjugation Unconjugated
PFKM Mouse Monoclonal Antibody [Clone ID: AT2F11]
AM50026PU-S

USD 315.00

3 Weeks

PFKM mouse monoclonal antibody, clone AT2F11, Purified

Applications ELISA, FC, WB
Reactivities Human
Conjugation Unconjugated
PFKM Sheep Polyclonal Antibody
AP21254AF-N

USD 330.00

2 Weeks

PFKM sheep polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Rabbit
Conjugation Unconjugated
Immunogen Fructose-6-Phosphate Kinase is isolated and purified from Rabbit muscle.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
PFKM Sheep Polyclonal Antibody
AP21254PU-N

USD 705.00

2 Weeks

PFKM sheep polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Rabbit
Conjugation Unconjugated
Immunogen Fructose-6-Phosphate Kinase is isolated and purified from Rabbit muscle.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
PFKM Rabbit Polyclonal Antibody
TA343124

USD 539.00

5 Days

Rabbit Polyclonal Anti-PFKM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA
PFKM Goat Polyclonal Antibody
TA396713S

USD 285.00

5 Days

Fructose-6-Phosphate Kinase Antibody

Applications ELISA, IF, WB
Reactivities Rabbit
Conjugation Unconjugated
Immunogen Full length native Fructose-6-Phosphate Kinase purified from rabbit muscle
PFKM Rabbit Polyclonal Antibody
TA332713

USD 365.00

3 Weeks

Rabbit anti-PFKM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PFKM
Fructose 6 Phosphate Kinase Goat Polyclonal Antibody
R1081PS

USD 765.00

3 Days

Fructose 6 Phosphate Kinase goat polyclonal antibody, Purified

Applications ELISA, IF, WB
Reactivities Rabbit
Conjugation Unconjugated
Immunogen Full length native Fructose-6-phosphate kinase / Phosphofructokinase  from rabbit muscle