SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SFRS9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SFRS9 antibody: synthetic peptide directed towards the middle region of human SFRS9. Synthetic peptide located within the following region: VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER |