Primary Antibodies

View as table Download

Rabbit anti-TRIM21 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TRIM21

Rabbit Polyclonal antibody to SSA1 (tripartite motif-containing 21)

Applications IF, IHC, WB
Reactivities Human (Predicted: Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 254 and 475 of SSA1 (Uniprot ID#P19474)

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRIM21 antibody was raised against an 16 amino acid peptide near the center of human TRIM21.

TRIM21 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-330 of human TRIM21 (NP_003132.2).
Modifications Unmodified

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: GELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEE

Rabbit Polyclonal Anti-TRIM21 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TRIM21

TRIM21 Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: CPVCRQRFLLKNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLH

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the C terminal of human TRIM21. Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ