Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]

Rabbit Polyclonal Anti-TRAK1 Antibody

Applications WB
Reactivities Human (Predicted: Cow, Dog, Pig, Rabbit, Rat, Horse)
Conjugation Unconjugated
Immunogen The immunogen for anti-TRAK1 antibody: synthetic peptide directed towards the middle region of human TRAK1. Synthetic peptide located within the following region: ILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFF

Rabbit polyclonal STAT2 phospho Y690 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee, Macaque, Monkey, Rat, Dog, Pig, Mouse, Bovine, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein.

Rabbit Polyclonal Anti-RHOC Antibody

Applications IHC, WB
Reactivities Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Goat Polyclonal Antibody against CRP2 / CSRP2

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Horse)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ERLGIKPESVQP, from the internal region of the protein sequence according to NP_001312.1.

Rabbit Polyclonal Antibody against VEGFA

Applications ELISA, WB
Reactivities Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692]

Rabbit Polyclonal Anti-SIAH3 Antibody

Applications WB
Reactivities Human (Predicted: Dog, Rabbit, Horse)
Conjugation Unconjugated
Immunogen The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA

Rabbit Polyclonal Anti-FAM86A Antibody

Applications WB
Reactivities Human (Predicted: Rat, Dog, Cow, Guinea Pig, Horse)
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE

Goat Anti-HOXD10 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Horse, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence PNRSCRIEQPVTQQ, from the internal region of the protein sequence according to NP_002139.2.

Goat Anti-SEPT7 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow, Horse)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DNNKNKGQLTKSP, from the internal region of the protein sequence according to NP_001779.3; NP_001011553.2.

Rabbit polyclonal anti-Oct-4 antibody

Applications WB
Reactivities Human, Monkey, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Oct-4 protein.

Rabbit polyclonal anti-NEDD4 antibody

Applications WB
Reactivities Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of the Nedd4 protein.

Rabbit polyclonal anti-ATDC antibody

Applications WB
Reactivities Human, Bovine, Chimpanzee, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Rabbit polyclonal ATDC Ac-K116 antibody

Applications WB
Reactivities Human, Bovine, Chimpanzee, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Human, Rat, Dog, Zebrafish, Bovine, Pig, Rabbit, Mouse, Guinea Pig, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI