Anti-GRK4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 36-145 amino acids of human G protein-coupled receptor kinase 4 |
Rabbit Polyclonal Anti-GRK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY |
Rabbit Polyclonal Anti-GRK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA |
GRK4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 359-578 of human GRK4 (NP_892027.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
