Primary Antibodies

View as table Download

Anti-TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase

Tyrosinase (TYR) (C-term) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 486-513 amino acids from the C-terminal region of Human Tyrosinase.

Rabbit polyclonal Tyrosinase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human tyrosinase.

Anti-TYR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase

TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TYR

Rabbit Polyclonal Anti-TYR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYR antibody: synthetic peptide directed towards the middle region of human TYR. Synthetic peptide located within the following region: CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM

Rabbit Polyclonal Anti-Tyrosinase Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Tyrosinase Antibody: A synthesized peptide derived from human Tyrosinase