Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against ATG5

Applications Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0]

Rabbit Polyclonal Antibody against Beclin 1

Applications FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen NB 500-249 was raised against an internal synthetic peptide to human Beclin 1, containing residues within 1-100. This sequence has 94% identity with the mouse sequence and 88% identity with the rat sequence.

Rabbit polyclonal ATG5 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Pig)
Conjugation Unconjugated
Immunogen This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ATG5.

Rabbit Polyclonal Beclin 1/ATG6 Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457]

Rabbit Polyclonal Anti-ATG5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Chicken, Pig, Rat, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)

Anti-BECN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 50-65 amino acids of Human Beclin-1

Rabbit Polyclonal Anti-ATG3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATG3

Rabbit Polyclonal Anti-ATG4A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATG4A

Rabbit polyclonal ATG7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat)
Conjugation Unconjugated
Immunogen This ATG7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 494-523 amino acids from human ATG7.

Goat Polyclonal Anti-ATG12 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 65 aa to the N-terminus of human ATG12 produced in E. coli.

AMPK alpha 1 (PRKAA1) pSer487 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AMPK alpha-1 around the phosphorylation site of serine 487 (S-G- SP-V-S).

AMPK alpha 1 (PRKAA1) pSer487 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AMPK alpha-1 around the phosphorylation site of serine 487 (S-G- SP-V-S).

Rabbit Polyclonal antibody to ULK2 (unc-51-like kinase 2 (C. elegans))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 693 and 968 of ULK2 (Uniprot ID#Q8IYT8)

Rabbit polyclonal ATG7 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Chicken)
Conjugation Unconjugated
Immunogen This ATG7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 540-569 amino acids from the C-terminal region of human ATG7.