Primary Antibodies

View as table Download

JAK3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-JAK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JAK3 Antibody is: synthetic peptide directed towards the N-terminal region of Human JAK3. Synthetic peptide located within the following region: APPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAE

Rabbit Polyclonal Anti-JAK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-JAK3 Antibody: synthetic peptide directed towards the middle region of human JAK3. Synthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF

Rabbit anti JAK3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from the adjacent to C-terminus of JAK3 protein. This sequence is identical in JAK3 from human, rat and mouse origins.