Primary Antibodies

Jump to Filters
View as table Download
HMBS Rabbit Polyclonal Antibody
TA327175

USD 365.00

3 Weeks

Rabbit anti-HMBS Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HMBS
HMBS Rabbit Polyclonal Antibody
TA334951

USD 539.00

5 Days

Rabbit Polyclonal Anti-HMBS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMBS antibody: synthetic peptide directed towards the N terminal of human HMBS. Synthetic peptide located within the following region: MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA
HMBS Rabbit Polyclonal Antibody
TA334952

USD 539.00

5 Days

Rabbit Polyclonal Anti-HMBS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMBS antibody: synthetic peptide directed towards the middle region of human HMBS. Synthetic peptide located within the following region: SSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQR